SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4503743|ref|NP_002009.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4503743|ref|NP_002009.1|
Domain Number 1 Region: 89-396
Classification Level Classification E-value
Superfamily L domain-like 9.18e-57
Family Leucine rich effector protein YopM 0.035
Further Details:      
 
Domain Number 2 Region: 489-629
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.96e-36
Family Gelsolin-like 0.00027
Further Details:      
 
Domain Number 3 Region: 1154-1262
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.63e-25
Family Gelsolin-like 0.00082
Further Details:      
 
Domain Number 4 Region: 609-720
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.54e-24
Family Gelsolin-like 0.00069
Further Details:      
 
Domain Number 5 Region: 899-943,977-1062
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.57e-23
Family Gelsolin-like 0.013
Further Details:      
 
Domain Number 6 Region: 698-848
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.7e-21
Family Gelsolin-like 0.0028
Further Details:      
 
Domain Number 7 Region: 7-119
Classification Level Classification E-value
Superfamily L domain-like 2.77e-19
Family Internalin LRR domain 0.066
Further Details:      
 
Domain Number 8 Region: 1052-1144
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0000000000000374
Family Gelsolin-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4503743|ref|NP_002009.1|
Sequence length 1269
Comment protein flightless-1 homolog [Homo sapiens]
Sequence
MEATGVLPFVRGVDLSGNDFKGGYFPENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEH
LSVSHNNLTTLHGELSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSHNQLTECP
RELENAKNMLVLNLSHNSIDTIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLV
LNGNPLLHAQLRQLPAMTALQTLHLRSTQRTQSNLPTSLEGLSNLADVDLSCNDLTRVPE
CLYTLPSLRRLNLSSNQITELSLCIDQWVHVETLNLSRNQLTSLPSAICKLSKLKKLYLN
SNKLDFDGLPSGIGKLTNLEEFMAANNNLELVPESLCRCPKLRKLVLNKNHLVTLPEAIH
FLTEIEVLDVRENPNLVMPPKPADRAAEWYNIDFSLQNQLRLAGASPATVAAAAAAGSGP
KDPMARKMRLRRRKDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGL
EKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGS
LNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISY
IEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWR
GAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKHVPED
FWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDC
WSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDD
VLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEW
NEDLDGMEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKKEDKEEKAE
GKEGEEATAEAEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPGKLEVVR
MTQQQENPKFLSHFKRKFIIHRGKRKAVQGAQQPSLYQIRTNGSALCTRCIQINTDSSLL
NSEFCFILKVPFESEDNQGIVYAWVGRASDPDEAKLAEDILNTMFDTSYSKQVINEGEEP
ENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKCSDFCQDDLADDDIMLLDN
GQEVYMWVGTQTSQVEIKLSLKACQVYIQHMRSKEHERPRRLRLVRKGNEQHAFTRCFHA
WSAFCKALA
Download sequence
Identical sequences Q13045
ENSP00000324573 gi|4503743|ref|NP_002009.1| ENSP00000324573 NP_002009.1.87134 NP_002009.1.92137 9606.ENSP00000324573 ENSP00000324573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]