SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4503755|ref|NP_002012.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4503755|ref|NP_002012.1|
Domain Number 1 Region: 3-219
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.33e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.01
Further Details:      
 
Domain Number 2 Region: 317-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000664
Family FAD/NAD-linked reductases, N-terminal and central domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4503755|ref|NP_002012.1|
Sequence length 532
Comment dimethylaniline monooxygenase [N-oxide-forming] 1 [Homo sapiens]
Sequence
MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVS
NSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSA
VSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPD
IFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQ
NMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIR
PSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAH
LQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWF
GLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGK
WEGARNAIMTQWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL
Download sequence
Identical sequences A0A024R934 Q01740
ENSP00000346901 ENSP00000356724 ENSP00000346901 gi|4503755|ref|NP_002012.1| NP_001269622.1.87134 NP_001269622.1.92137 NP_002012.1.87134 NP_002012.1.92137 9606.ENSP00000346901 ENSP00000346901 ENSP00000356724 ENSP00000481732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]