SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4504073|ref|NP_000398.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4504073|ref|NP_000398.1|
Domain Number 1 Region: 58-122
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000146
Family Ngr ectodomain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4504073|ref|NP_000398.1|
Sequence length 206
Comment platelet glycoprotein Ib beta chain precursor [Homo sapiens]
Sequence
MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTEL
VLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVA
PPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRA
RARARAAARLSLTDPLVAERAGTDES
Download sequence
Identical sequences G3SFA3 P13224
ENSGGOP00000026787 ENSGGOP00000026787 ENSP00000383382 ENSP00000383382 NP_000398.1.87134 NP_000398.1.92137 9606.ENSP00000383382 gi|4504073|ref|NP_000398.1| ENSP00000383382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]