SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4504077|ref|NP_000165.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4504077|ref|NP_000165.1|
Domain Number 1 Region: 53-114
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000485
Family Ngr ectodomain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4504077|ref|NP_000165.1|
Sequence length 177
Comment platelet glycoprotein IX precursor [Homo sapiens]
Sequence
MPAWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALPARTRHLLLAN
NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAA
HGPLGRLTGYQLGSCGWQLQASWVRPGVLWDVALVAVAALGLALLAGLLCATTEALD
Download sequence
Identical sequences P14770
9606.ENSP00000303942 ENSP00000303942 gi|4504077|ref|NP_000165.1| ENSP00000303942 NP_000165.1.87134 NP_000165.1.92137 XP_005247431.1.92137 XP_011511003.1.92137 XP_011511004.1.92137 ENSP00000303942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]