SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4504173|ref|NP_001503.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4504173|ref|NP_001503.1|
Domain Number 1 Region: 81-218
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.04e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.0000312
Further Details:      
 
Domain Number 2 Region: 6-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.79e-27
Family Glutathione S-transferase (GST), N-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4504173|ref|NP_001503.1|
Sequence length 222
Comment glutathione S-transferase A4 [Homo sapiens]
Sequence
MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEI
DGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKE
VVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPF
LQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Download sequence
Identical sequences A0A024RD58 G1QTY7 G3QRL1 H2PJD6 O15217
ENSPPYP00000018699 ENSP00000359998 ENSP00000359998 ENSP00000360002 ENSNLEP00000004407 ENSGGOP00000005267 1gul_A 1gul_B 1gul_C 1gul_D 1gul_E 1gul_F 1gul_G 1gul_H 1gum_A 1gum_B 1gum_C 1gum_D 1gum_E 1gum_F 1gum_G 1gum_H 3ik7_A 3ik7_B 3ik7_C 3ik7_D NP_001503.1.87134 NP_001503.1.92137 XP_002817054.1.23681 XP_003254195.1.23891 XP_004044256.1.27298 XP_005249092.1.92137 XP_009240236.1.23681 XP_009240237.1.23681 XP_009240238.1.23681 XP_012357183.1.23891 XP_012357184.1.23891 ENSPPYP00000018699 1gulA 9600.ENSPPYP00000018699 9606.ENSP00000359998 gi|4504173|ref|NP_001503.1| ENSP00000359998 ENSP00000360002 399915 ENSNLEP00000004407 ENSGGOP00000005267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]