SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4504179|ref|NP_000841.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4504179|ref|NP_000841.1|
Domain Number 1 Region: 86-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.77e-46
Family Glutathione S-transferase (GST), C-terminal domain 0.000000144
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.72e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4504179|ref|NP_000841.1|
Sequence length 218
Comment glutathione S-transferase Mu 4 isoform 1 [Homo sapiens]
Sequence
MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDF
EKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
Download sequence
Identical sequences A0A140VKE3 Q03013
399873 9606.ENSP00000358851 ENSP00000358851 gi|4504179|ref|NP_000841.1| NP_000841.1.87134 NP_000841.1.92137 ENSP00000358851 ENSP00000316471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]