SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4504777|ref|NP_000880.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4504777|ref|NP_000880.1|
Domain Number 1 Region: 147-391
Classification Level Classification E-value
Superfamily vWA-like 2.61e-81
Family Integrin A (or I) domain 0.00000031
Further Details:      
 
Domain Number 2 Region: 379-481
Classification Level Classification E-value
Superfamily Integrin domains 1.41e-24
Family Integrin domains 0.0033
Further Details:      
 
Domain Number 3 Region: 644-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000366
Family Integrin beta tail domain 0.0092
Further Details:      
 
Domain Number 4 Region: 43-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000194
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 602-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000014
Family Integrin beta EGF-like domains 0.0061
Further Details:      
 
Domain Number 6 Region: 560-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Integrin beta EGF-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  gi|4504777|ref|NP_000880.1|
Domain Number - Region: 531-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4504777|ref|NP_000880.1|
Sequence length 798
Comment integrin beta-7 precursor [Homo sapiens]
Sequence
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL
Download sequence
Identical sequences P26010
9606.ENSP00000267082 ENSP00000267082 ENSP00000408741 ENSP00000267082 gi|4504777|ref|NP_000880.1| NP_000880.1.87134 NP_000880.1.92137 XP_005268908.1.92137 XP_005268909.1.92137 ENSP00000267082 ENSP00000408741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]