SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4505047|ref|NP_002336.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4505047|ref|NP_002336.1|
Domain Number 1 Region: 31-330
Classification Level Classification E-value
Superfamily L domain-like 2.38e-47
Family Ngr ectodomain-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4505047|ref|NP_002336.1|
Sequence length 338
Comment lumican precursor [Homo sapiens]
Sequence
MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKS
VPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKK
LHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAF
KGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNE
LADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGP
LSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
Download sequence
Identical sequences P51884
ENSP00000266718 9606.ENSP00000266718 ENSP00000266718 NP_002336.1.87134 NP_002336.1.92137 ENSP00000266718 gi|4505047|ref|NP_002336.1| GO.39341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]