SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4505355|ref|NP_002479.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4505355|ref|NP_002479.1|
Domain Number 1 Region: 16-97
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.6e-26
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.00000681
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4505355|ref|NP_002479.1|
Sequence length 99
Comment NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 isoform 1 [Homo sapiens]
Sequence
MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSD
VQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
Download sequence
Identical sequences O43678
9606.ENSP00000252102 ENSP00000252102 NP_002479.1.87134 NP_002479.1.92137 ENSP00000252102 gi|4505355|ref|NP_002479.1| ENSP00000252102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]