SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4505463|ref|NP_003623.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4505463|ref|NP_003623.1|
Domain Number 1 Region: 143-330
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.85e-38
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 2 Region: 33-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.98e-36
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00069
Further Details:      
 
Domain Number 3 Region: 333-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.05e-32
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 4 Region: 967-1020,1082-1216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.64e-32
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 5 Region: 777-959
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6e-28
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 6 Region: 571-628
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000124
Family Fibrinogen C-terminal domain-like 0.0027
Further Details:      
 
Domain Number 7 Region: 542-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000144
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4505463|ref|NP_003623.1|
Sequence length 1384
Comment contactin-associated protein 1 precursor [Homo sapiens]
Sequence
MMHLRLFCILLAAVSGAEGWGYYGCDEELVGPLYARSLGASSYYSLLTAPRFARLHGISG
WSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHN
STFFGNVNESAVVRHDLHFHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKADILYFDGD
DAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTLELEGAHLLLHMSLGS
SPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDVNFTLDGYVQRFILNGDFERLNLDTE
MFIGGLVGAARKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEGKVAFRCLDPVP
HPINFGGPHNFVQVPGFPRRGRLAVSFRFRTWDLTGLLLFSRLGDGLGHVELTLSEGQVN
VSIAQSGRKKLQFAAGYRLNDGFWHEVNFVAQENHAVISIDDVEGAEVRVSYPLLIRTGT
SYFFGGCPKPASRWDCHSNQTAFHGCMELLKVDGQLVNLTLVEGRRLGFYAEVLFDTCGI
TDRCSPNMCEHDGRCYQSWDDFICYCELTGYKGETCHTPLYKESCEAYRLSGKTSGNFTI
DPDGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMERPFLGAIQYWNASWEEVS
ALANASQHCEQWIEFSCYNSRLLNTAGGYPYSFWIGRNEEQHFYWGGSQPGIQRCACGLD
RSCVDPALYCNCDADQPQWRTDKGLLTFVDHLPVTQVVIGDTNRSTSEAQFFLRPLRCYG
DRNSWNTISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENMGGPYCQWRRPYVRV
ELNTSRDVVFAFDVGNGDENLTVHSDDFEFNDDEWHLVRAEINVKQARLRVDHRPWVLRP
MPLQTYIWMEYDQPLYVGSAELKRRPFVGCLRAMRLNGVTLNLEGRANASEGTSPNCTGH
CAHPRLPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMRYNLQSALRSA
AREFSHMLSRPVPGYEPGYIPGYDTPGYVPGYHGPGYRLPDYPRPGRPVPGYRGPVYNVT
GEEVSFSFSTSSAPAVLLYVSSFVRDYMAVLIKDDGTLQLRYQLGTSPYVYQLTTRPVTD
GQPHSINITRVYRNLFIQVDYFPLTEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQR
YNTPGFSGCLSGVRFNNVAPLKTHFRTPRPMTAELAEALRVQGELSESNCGAMPRLVSEV
PPELDPWYLPPDFPYYHDEGWVAILLGFLVAFLLLGLVGMLVLFYLQNHRYKGSYHTNEP
KAAHEYHPGSKPPLPTSGPAQVPTPTAAPNQAPASAPAPAPTPAPAPGPRDQNLPQILEE
SRSE
Download sequence
Identical sequences H2R9Q6 P78357
ENSP00000264638 9598.ENSPTRP00000053077 9606.ENSP00000264638 gi|4505463|ref|NP_003623.1| ENSP00000264638 ENSPTRP00000053077 NP_003623.1.87134 NP_003623.1.92137 XP_003813950.1.60992 XP_016787257.1.37143 XP_016880727.1.92137 ENSPTRP00000053077 ENSP00000264638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]