SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4505507|ref|NP_002538.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4505507|ref|NP_002538.1|
Domain Number 1 Region: 5-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.13e-71
Family BAR domain 0.0035
Further Details:      
 
Domain Number 2 Region: 389-564
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00000207
Further Details:      
 
Domain Number 3 Region: 263-364
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-16
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4505507|ref|NP_002538.1|
Sequence length 802
Comment oligophrenin-1 [Homo sapiens]
Sequence
MGHPPLEFSDCYLDSPDFRERLKCYEQELERTNKFIKDVIKDGNALISAMRNYSSAVQKF
SQTLQSFQFDFIGDTLTDDEINIAESFKEFAELLNEVENERMMMVHNASDLLIKPLENFR
KEQIGFTKERKKKFEKDGERFYSLLDRHLHLSSKKKESQLQEADLQVDKERHNFFESSLD
YVYQIQEVQESKKFNIVEPVLAFLHSLFISNSLTVELTQDFLPYKQQLQLSLQNTRNHFS
STREEMEELKKRMKEAPQTCKLPGQPTIEGYLYTQEKWALGISWVKYYCQYEKETKTLTM
TPMEQKPGAKQGPLDLTLKYCVRRKTESIDKRFCFDIETNERPGTITLQALSEANRRLWM
EAMDGKEPIYHSPITKQQEMELNEVGFKFVRKCINIIETKGIKTEGLYRTVGSNIQVQKL
LNAFFDPKCPGDVDFHNSDWDIKTITSSLKFYLRNLSEPVMTYRLHKELVSAAKSDNLDY
RLGAIHSLVYKLPEKNREMLELLIRHLVNVCEHSKENLMTPSNMGVIFGPTLMRAQEDTV
AAMMNIKFQNIVVEILIEHFGKIYLGPPEESAAPPVPPPRVTARRHKPITISKRLLRERT
VFYTSSLDESEDEIQHQTPNGTITSSIEPPKPPQHPKLPIQRSGETDPGRKSPSRPILDG
KLEPCPEVDVGKLVSRLQDGGTKITPKATNGPMPGSGPTKTPSFHIKRPAPRPLAHHKEG
DADSFSKVRPPGEKPTIIRPPVRPPDPPCRAATPQKPEPKPDIVAGNAGEITSSVVASRT
RFFETASRKTGSSQGRLPGDES
Download sequence
Identical sequences O60890
ENSP00000347710 gi|4505507|ref|NP_002538.1| ENSP00000347710 HR4439 9606.ENSP00000347710 NP_002538.1.87134 NP_002538.1.92137 XP_011529263.1.92137 ENSP00000347710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]