SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4505873|ref|NP_002653.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4505873|ref|NP_002653.1|
Domain Number 1 Region: 315-494
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.34e-32
Family Phospholipase D 0.049
Further Details:      
 
Domain Number 2 Region: 725-941
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.55e-29
Family Nuclease 0.035
Further Details:      
 
Domain Number 3 Region: 78-212
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000563
Family PX domain 0.0071
Further Details:      
 
Domain Number 4 Region: 223-328
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000219
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 5 Region: 667-723
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000014
Family Phospholipase D 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4505873|ref|NP_002653.1|
Sequence length 1074
Comment phospholipase D1 isoform a [Homo sapiens]
Sequence
MSLKNEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSA
IYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRR
KQLEDYLTKILKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGIRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENALAKWYVNAKG
YFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTSGPSLGSLPPAAMESMESLRLKDKNEPVQNLPIQKS
IDDVDSKLKGIGKPRKFSKFSLYKQLHRHHLHDADSISSIDSTSSYFNHYRSHHNLIHGL
KPHFKLFHPSSESEQGLTRPHADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLL
PKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVHVIENSRHYIYIE
NQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARGLRLQCF
RVVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFI
NKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
Download sequence
Identical sequences Q13393
9606.ENSP00000342793 NP_002653.1.87134 NP_002653.1.92137 XP_005247590.1.92137 gi|4505873|ref|NP_002653.1| ENSP00000340326 ENSP00000342793 HR3288 ENSP00000342793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]