SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4506025|ref|NP_000936.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506025|ref|NP_000936.1|
Domain Number 1 Region: 9-156
Classification Level Classification E-value
Superfamily EF-hand 5.53e-60
Family Calmodulin-like 0.000092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4506025|ref|NP_000936.1|
Sequence length 170
Comment calcineurin subunit B type 1 [Homo sapiens]
Sequence
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Download sequence
Identical sequences A0A096M6D7 A0A096NE24 A0A098M029 A0A0B8RSB2 A0A0D9RQT1 A0A0P6J8W6 A0A0Q3U4K3 A0A0S7HHU0 A0A151MH36 A0A1A7Z1I1 A0A1A7ZB48 A0A1A8DIQ9 A0A1A8EYN7 A0A1A8JMT2 A0A1A8MU34 A0A1A8NA62 A0A1L8G736 A0A1W4Z598 A0A1W7RIU2 A0A218UVB1 A0A250XVP0 A0A287ACI6 A0A2I4CLA3 A0A2J8XBZ9 A0A2K5DVI7 A0A2K5MJL9 A0A2K5R722 A0A2K5UWG8 A0A2K6E0A6 A0A2K6G3B0 F7GNF2 G1RG24 H3A170 H3CWS9 H9EN69 J3SE33 K7BDX2 P63098 P63099 P63100 Q63810 Q66HZ0 Q6VN50 Q6VN51 T1E721 U3FXD1 U3KGU1 U6CRE8 W5UB88
ENSP00000234310 ENSMUSP00000099944 ENSBTAP00000014038 ENSMUSP00000099944 ENSTNIP00000012713 ENSFALP00000014245 ENSTNIP00000012713 ENSGALP00000014233 ENSPANP00000011132 cath|current|1mf8B00/5-168 ENSXETP00000037793 ENSNLEP00000012174 ENSRNOP00000058834 ENSP00000234310 gi|4506025|ref|NP_000936.1| ENSBTAP00000014038 10090.ENSMUSP00000099944 7955.ENSDARP00000022350 9031.ENSGALP00000014233 9606.ENSP00000234310 9913.ENSBTAP00000014038 99883.ENSTNIP00000012713 ENSMUSP00000099944 ENSLACP00000003391 ENSPVAP00000016973 NP_000936.1.87134 NP_000936.1.92137 NP_001004553.1.45394 NP_001257649.1.60252 NP_059005.1.100692 NP_059005.1.4139 NP_077779.2.92730 NP_777008.1.59421 NP_777008.1.76553 NP_989400.1.99540 NP_989707.1.86415 XP_002199881.1.42559 XP_003262525.1.23891 XP_003309092.1.37143 XP_003438369.1.78416 XP_004277059.2.21590 XP_004397556.1.74151 XP_004435661.1.5094 XP_004553502.1.88231 XP_004580140.1.84141 XP_004691525.2.23501 XP_004850000.1.39548 XP_005042973.1.66865 XP_005366492.1.66349 XP_005489458.1.73095 XP_005575763.1.63531 XP_005733778.1.53837 XP_005922476.1.24487 XP_006005182.1.90931 XP_006077706.1.26621 XP_006730051.1.47382 XP_006783615.1.46954 XP_006909598.1.64745 XP_007551154.1.10163 XP_007670273.1.37387 XP_007938268.1.48129 XP_007968602.1.81039 XP_008113131.1.98722 XP_008303170.1.38333 XP_008319522.1.100486 XP_008427078.1.1237 XP_008698161.1.72690 XP_008832053.1.79516 XP_009235510.1.23681 XP_010573076.1.12557 XP_011363903.1.92234 XP_011598754.1.59079 XP_011601394.1.43653 XP_011711762.1.29376 XP_011895039.1.92194 XP_012395620.1.9362 XP_012501955.1.63892 XP_012605585.1.48125 XP_012662883.1.62490 XP_012728265.1.37407 XP_013880775.1.33752 XP_014110154.1.90289 XP_014450523.1.47583 XP_014748336.1.99236 XP_014820073.1.91963 XP_014830264.1.96476 XP_014870383.1.100837 XP_014968077.1.72884 XP_015252390.1.42780 XP_015476226.1.82291 XP_015711996.1.68032 XP_015800511.1.37898 XP_015993364.1.101085 XP_017290733.1.84151 XP_017312712.1.5077 XP_017319310.1.5077 XP_017377599.1.71028 XP_017549600.1.86671 XP_017576170.1.86671 XP_017674306.1.3805 XP_017910928.1.57651 XP_018118297.1.7800 XP_018422448.1.44173 XP_018517095.1.34915 XP_018595711.1.37976 XP_018975376.1.5815 XP_019295966.1.44245 XP_019404694.1.79039 XP_019468088.1.16129 XP_019491224.1.44202 XP_019573799.1.88060 XP_019825976.1.53367 XP_019951367.1.63745 XP_020030770.1.5219 XP_020388839.1.65276 XP_020457278.1.23826 XP_020671537.1.8467 XP_020671538.1.8467 XP_020734267.1.74333 XP_020777030.1.12261 XP_020841068.1.61212 XP_020943085.1.46622 XP_021066262.1.100879 XP_021247926.1.32913 XP_021411538.1.53032 XP_021509820.1.76796 XP_021526734.1.9421 XP_021554810.1.83697 XP_022057494.1.10920 ENSGALP00000014233 ENSCJAP00000012079 ENSCJAP00000012084 1mf8_B 4f0z_B 4or9_B 4ora_B 4orb_B 4orc_B 5sve_B ENSXETP00000037793 gi|33355446|gb|AAQ16148| gi|40674512|gb|AAH64854| gi|45361647|ref|NP_989400| ENSDARP00000091642 gi|160420315|ref|NP_001086375| gi|49522930|gb|AAH75185| ENSPVAP00000016973 1mf8B ENSDARP00000091642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]