SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4506115|ref|NP_000303.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506115|ref|NP_000303.1|
Domain Number 1 Region: 151-451
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.34e-80
Family Eukaryotic proteases 0.00000000342
Further Details:      
 
Domain Number 2 Region: 42-97
Classification Level Classification E-value
Superfamily GLA-domain 1.58e-19
Family GLA-domain 0.00032
Further Details:      
 
Domain Number 3 Region: 98-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family EGF-type module 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4506115|ref|NP_000303.1|
Sequence length 461
Comment vitamin K-dependent protein C preproprotein [Homo sapiens]
Sequence
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI
EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC
DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK
FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA
VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL
NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP
Download sequence
Identical sequences P04070
NP_000303.1.87134 NP_000303.1.92137 gi|4506115|ref|NP_000303.1| ENSP00000234071 ENSP00000409543 ENSP00000234071 9606.ENSP00000234071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]