SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4506121|ref|NP_003882.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506121|ref|NP_003882.1|
Domain Number 1 Region: 137-400
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.18e-37
Family Eukaryotic proteases 0.00053
Further Details:      
 
Domain Number 2 Region: 43-104
Classification Level Classification E-value
Superfamily GLA-domain 2.75e-22
Family GLA-domain 0.00053
Further Details:      
 
Domain Number 3 Region: 93-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000147
Family EGF-type module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4506121|ref|NP_003882.1|
Sequence length 400
Comment vitamin K-dependent protein Z precursor [Homo sapiens]
Sequence
MAGCVPLLQGLVLVLALHRVEPSVFLPASKANDVLVRWKRAGSYLLEELFEGNLEKECYE
EICVYEEAREVFENEVVTDEFWRRYKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGS
NCELAKNECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSEK
RAPDLQDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTYFNRTSQDPL
MIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLL
SGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTRE
HRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMN
Download sequence
Identical sequences P22891
NP_003882.1.87134 NP_003882.1.92137 ENSP00000364697 gi|4506121|ref|NP_003882.1| ENSP00000364697 9606.ENSP00000364697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]