SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4506301|ref|NP_002824.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506301|ref|NP_002824.1|
Domain Number 1 Region: 290-576
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.9e-106
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000268
Further Details:      
 
Domain Number 2 Region: 87-262
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.71e-35
Family CRAL/TRIO domain 0.0004
Further Details:      
 
Domain Number 3 Region: 3-82
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000000000392
Family CRAL/TRIO N-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4506301|ref|NP_002824.1|
Sequence length 593
Comment tyrosine-protein phosphatase non-receptor type 9 [Homo sapiens]
Sequence
MEPATAPRPDMAPELTPEEEQATKQFLEEINKWTVQYNVSPLSWNVAVKFLMARKFDVLR
AIELFHSYRETRRKEGIVKLKPHEEPLRSEILSGKFTILNVRDPTGASIALFTARLHHPH
KSVQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFP
ARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQILKTSEVTQHLPRECLPENLGGYVK
IDLATWNFQFLPQVNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQELVDYVNARQK
QGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINA
SFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEK
DSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASL
IDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGT
LNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ
Download sequence
Identical sequences A0A2I2YM55 A0A2J8UDR5 K7CI13 P43378
NYSGXRC-8607a NP_002824.1.87134 NP_002824.1.92137 XP_018866273.1.27298 ENSP00000482732 ENSP00000303554 gi|4506301|ref|NP_002824.1| 9606.ENSP00000303554 ENSP00000303554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]