SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4506335|ref|NP_002845.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506335|ref|NP_002845.1|
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily EF-hand 4.91e-24
Family Parvalbumin 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4506335|ref|NP_002845.1|
Sequence length 110
Comment parvalbumin alpha [Homo sapiens]
Sequence
MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIE
EDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Download sequence
Identical sequences A0A024R1K9 P20472
1rjvA 1rjv_A 1rk9_A cath|current|1rjvA00/1-110 cath|current|1rk9A00/1-110 d1rjva_ d1rk9a_ ENSP00000216200 ENSP00000400247 ENSP00000480913 NP_001302461.1.87134 NP_001302461.1.92137 NP_002845.1.87134 NP_002845.1.92137 9606.ENSP00000216200 gi|4506335|ref|NP_002845.1| ENSP00000216200 ENSP00000400247 CIRMMP07 ENSP00000216200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]