SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4506431|ref|NP_002881.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506431|ref|NP_002881.1|
Domain Number 1 Region: 718-1040
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-91
Family p120GAP domain-like 0.0000000000112
Further Details:      
 
Domain Number 2 Region: 344-451
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-27
Family SH2 domain 0.00069
Further Details:      
 
Domain Number 3 Region: 165-264
Classification Level Classification E-value
Superfamily SH2 domain 1.29e-26
Family SH2 domain 0.00048
Further Details:      
 
Domain Number 4 Region: 469-576
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-24
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 
Domain Number 5 Region: 596-732
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.51e-17
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 6 Region: 272-345
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000538
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4506431|ref|NP_002881.1|
Sequence length 1047
Comment ras GTPase-activating protein 1 isoform 1 [Homo sapiens]
Sequence
MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGT
LGGGAALGSEFLGAGSVAGALGGAGLTGGGTAAGVAGAAAGVAGAAVAGPSGDMALTKLP
TSLLAETLGPGGGFPPLPPPPYLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQ
WYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYY
IGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEIS
FLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQE
AYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIG
DIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGY
LLKKGKGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNC
FQIVVQHFSEEHYIFYFAGETPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHI
EEAHKLPVKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPPDINRFEITLSN
KTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPE
EEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISM
EDEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNED
VNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFV
FLRLICPAILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFI
KSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQ
HVLKKLLAITELLQQKQNQYTKTNDVR
Download sequence
Identical sequences P20936
gi|4506431|ref|NP_002881.1| NP_002881.1.87134 NP_002881.1.92137 ENSP00000274376 ENSP00000274376 HR4601 9606.ENSP00000274376 ENSP00000274376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]