SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4506457|ref|NP_002893.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506457|ref|NP_002893.1|
Domain Number 1 Region: 155-308
Classification Level Classification E-value
Superfamily EF-hand 1.26e-24
Family Calmodulin-like 0.033
Further Details:      
 
Domain Number 2 Region: 60-177
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000861
Family Calbindin D9K 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4506457|ref|NP_002893.1|
Sequence length 317
Comment reticulocalbin-2 precursor [Homo sapiens]
Sequence
MRLGPRTAALGLLLLCAAAAGAGKAEELHYPLGERRSDYDREALLGVQEDVDEYVKLGHE
EQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDTVTWD
EYNIQMYDRVIDFDENTALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHP
EEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGDYRWDPTANEDPEWILVEKDRFVNDYD
KDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILENPDLFLTSEA
TDYGRQLHDDYFYHDEL
Download sequence
Identical sequences A0A2J8RQT0 G3SIR6 K7DMM7 Q14257
NYSGRC-4506457 gi|4506457|ref|NP_002893.1| ENSNLEP00000023605 ENSP00000378349 NP_002893.1.87134 NP_002893.1.92137 XP_004056623.1.27298 9600.ENSPPYP00000007577 9606.ENSP00000378349 ENSP00000378349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]