SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4506459|ref|NP_002894.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506459|ref|NP_002894.1|
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily EF-hand 1.26e-44
Family Calmodulin-like 0.0000000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4506459|ref|NP_002894.1|
Sequence length 200
Comment recoverin [Homo sapiens]
Sequence
MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDT
DPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKN
EVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANK
EILRLIQFEPQKVKEKMKNA
Download sequence
Identical sequences G3QZN4 H2NSQ6 H2QC95 P35243
hsi002004436.1 ENSP00000226193 ENSP00000226193 gi|4506459|ref|NP_002894.1| ENSGGOP00000008349 ENSPTRP00000014928 ENSP00000226193 ENSPTRP00000014928 ENSGGOP00000008349 NP_002894.1.87134 NP_002894.1.92137 XP_002827073.1.23681 XP_003818145.1.60992 XP_004058625.1.27298 XP_009431030.1.37143 ENSPPYP00000008969 9598.ENSPTRP00000014928 9600.ENSPPYP00000008969 9606.ENSP00000226193 ENSPPYP00000008969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]