SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4506761|ref|NP_002957.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506761|ref|NP_002957.1|
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily EF-hand 7.35e-24
Family S100 proteins 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4506761|ref|NP_002957.1|
Sequence length 97
Comment protein S100-A10 [Homo sapiens]
Sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD
QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Download sequence
Identical sequences A0A096MSI7 A0A0P6K1K7 A0A1U7U2W8 A0A2I2ZWR8 A0A2J8VFE1 A0A2K5DFS3 A0A2K5JF56 A0A2K5KUS4 A0A2K5XGX7 A0A2K6C8P3 A0A2K6LLV3 A0A2K6R4F1 F2Z5M2 F7FGI3 G1RRP8 G3T711 G3WV01 G7MDL9 G7NTU2 H2Q001 I3N1Z2 L8ILK4 P60902 P60903 P62504 Q6SQH4 W5QIU9
ENSPANP00000002756 ENSSHAP00000019256 ENSSHAP00000019256 ENSGGOP00000024526 ENSOCUP00000004503 ENSP00000357799 ENSTTRP00000008194 ENSLAFP00000009356 ENSSTOP00000018388 gi|4506761|ref|NP_002957.1| 9544.ENSMMUP00000039024 9598.ENSPTRP00000002222 9600.ENSPPYP00000000992 9606.ENSP00000357799 9823.ENSSSCP00000007051 9913.ENSBTAP00000020150 9986.ENSOCUP00000004503 ENSTTRP00000008194 ENSMMUP00000015300 ENSGGOP00000024526 ENSVPAP00000003186 ENSPTRP00000002222 ENSMMUP00000015300 ENSMMUP00000039024 ENSLAFP00000009356 ENSBTAP00000020150 ENSOCUP00000004503 ENSNLEP00000015913 ENSP00000357799 ENSP00000357801 ENSBTAP00000020150 ENSCJAP00000015024 ENSCJAP00000041063 ENSSSCP00000007051 ENSVPAP00000003186 ENSTSYP00000012920 NP_001028124.1.72884 NP_001075632.1.1745 NP_001265347.1.72884 NP_001278853.1.46622 NP_002957.1.87134 NP_002957.1.92137 NP_777075.1.59421 NP_777075.1.76553 XP_002749906.1.60252 XP_003282254.1.23891 XP_003355214.1.46622 XP_003409499.1.64505 XP_003735167.1.60252 XP_003769990.1.9362 XP_003775619.1.23681 XP_003817271.1.60992 XP_004026718.1.27298 XP_004026719.1.27298 XP_004285280.1.21590 XP_004436092.1.5094 XP_004854168.1.39548 XP_005541900.1.63531 XP_005541901.1.63531 XP_005663494.1.46622 XP_005663495.1.46622 XP_005895039.1.15283 XP_005970692.1.78601 XP_006050865.1.26621 XP_006080859.1.26621 XP_006217073.1.17985 XP_007122633.1.24612 XP_007460364.1.90284 XP_007975340.1.81039 XP_008059637.1.4292 XP_009242567.1.23681 XP_009429877.1.37143 XP_010385429.1.97406 XP_010855770.1.44457 XP_011767688.1.29376 XP_011767690.1.29376 XP_011767691.1.29376 XP_011767692.1.29376 XP_011793297.1.43180 XP_011793298.1.43180 XP_011793299.1.43180 XP_011828889.1.47321 XP_011828890.1.47321 XP_011828891.1.47321 XP_011891172.1.92194 XP_011925043.1.92194 XP_012021685.1.54773 XP_012318166.1.9421 XP_012326754.1.9421 XP_012394303.1.21590 XP_014333453.1.15283 XP_014947734.1.66739 XP_015005957.1.72884 XP_015005963.1.72884 XP_015005974.1.72884 XP_015312662.1.63531 XP_015358385.1.40921 XP_017710401.1.44346 XP_017733116.1.44346 XP_017733117.1.44346 XP_017901595.1.57651 XP_019484500.1.44202 XP_019775102.1.83887 XP_019810990.1.53367 XP_020730058.1.74333 XP_020730059.1.74333 XP_021586150.1.77405 ENSCJAP00000015024 ENSCJAP00000041063 ENSTSYP00000012920 ENSNLEP00000015913 ENSOARP00000022651 ENSP00000357799 ENSP00000357801 ENSPTRP00000002222 ENSSSCP00000007051 ENSSSCP00000029472 ENSSSCP00000030365 ENSSSCP00000030391 ENSSTOP00000018388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]