SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4506765|ref|NP_002952.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506765|ref|NP_002952.1|
Domain Number 1 Region: 4-92
Classification Level Classification E-value
Superfamily EF-hand 9.49e-24
Family S100 proteins 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4506765|ref|NP_002952.1|
Sequence length 101
Comment protein S100-A4 [Homo sapiens]
Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMS
NLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Download sequence
Identical sequences A0A0D9S5N9 A0A2K5K2N5 A0A2K5L9P8 A0A2K5RLK4 A0A2K5YBE3 A0A2K6BHX4 F7GDB8 G1RHG0 G3QWC6 G7NUG6 H2N5P0 H2Q029 P26447
gi|4506765|ref|NP_002952.1| gi|9845516|ref|NP_062427.1| 1m31_A 1m31_B 2q91_A 2q91_B 3cga_A 3cga_B 3ko0_A 3ko0_B 3ko0_C 3ko0_D 3ko0_E 3ko0_F 3ko0_G 3ko0_H 3ko0_I 3ko0_J 3ko0_K 3ko0_L 3ko0_M 3ko0_N 3ko0_O 3ko0_P 3ko0_Q 3ko0_R 3ko0_S 3ko0_T 000149491|e2lnkA1|108.1.1.145|A:13-113 cath|current|1m31A00/1-101 cath|current|1m31B00/1-101 cath|current|2q91A00/2-97 cath|current|2q91B00/2-97 cath|current|3cgaA00/4-90 cath|current|3cgaB00/4-90 cath|current|3ko0A00/2-94 cath|current|3ko0B00/2-94 cath|current|3ko0C00/2-94 cath|current|3ko0D00/2-94 cath|current|3ko0E00/2-93 cath|current|3ko0F00/2-94 cath|current|3ko0G00/2-94 cath|current|3ko0H00/2-95 cath|current|3ko0I00/2-94 cath|current|3ko0J00/2-94 cath|current|3ko0K00/2-94 cath|current|3ko0L00/2-94 cath|current|3ko0M00/2-93 cath|current|3ko0N00/2-93 cath|current|3ko0O00/2-94 cath|current|3ko0P00/2-93 cath|current|3ko0Q00/2-95 cath|current|3ko0R00/2-94 cath|current|3ko0S00/2-94 cath|current|3ko0T00/2-94 d1m31a_ d1m31b_ ENSGGOP00000007082 ENSMMUP00000014389 ENSP00000346294 NP_002952.1.87134 NP_002952.1.92137 NP_062427.1.87134 NP_062427.1.92137 XP_001138920.1.37143 XP_002801839.1.72884 XP_002810198.1.23681 XP_003259347.1.23891 XP_003259348.1.23891 XP_003259349.1.23891 XP_003259350.1.23891 XP_003817214.1.60992 XP_004026781.1.27298 XP_005541835.1.63531 XP_007975275.1.81039 XP_008968601.1.60992 XP_011767776.1.29376 XP_011783513.1.43180 XP_011783514.1.43180 XP_011783515.1.43180 XP_011783516.1.43180 XP_011823579.1.47321 XP_011823580.1.47321 XP_011823581.1.47321 XP_011823582.1.47321 XP_011931975.1.92194 XP_012366970.1.23891 XP_012366971.1.23891 XP_017368788.1.71028 XP_017368789.1.71028 XP_513815.2.37143 ENSPTRP00000002273 ENSPPYP00000000945 2q91A ENSPPYP00000000945 ENSGGOP00000007082 ENSNLEP00000012660 9544.ENSMMUP00000038987 9598.ENSPTRP00000002273 9600.ENSPPYP00000000945 9606.ENSP00000346294 ENSP00000346294 ENSP00000357703 ENSP00000357704 ENSP00000357705 ENSNLEP00000012660 ENSMMUP00000014389 ENSMMUP00000038987 ENSP00000346294 ENSP00000357703 ENSP00000357704 ENSP00000357705 ENSPTRP00000002273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]