SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4506773|ref|NP_002956.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506773|ref|NP_002956.1|
Domain Number 1 Region: 5-96
Classification Level Classification E-value
Superfamily EF-hand 1.38e-23
Family S100 proteins 0.0000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4506773|ref|NP_002956.1|
Sequence length 114
Comment protein S100-A9 [Homo sapiens]
Sequence
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE
HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Download sequence
Identical sequences G3QEY7 P06702
ENSGGOP00000000844 9606.ENSP00000357727 ENSP00000357727 gi|4506773|ref|NP_002956.1| ENSGGOP00000000844 ENSP00000357727 NP_002956.1.87134 NP_002956.1.92137 XP_004026771.1.27298 ENSP00000357727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]