SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4506887|ref|NP_003000.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506887|ref|NP_003000.1|
Domain Number 1 Region: 3-79
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.27e-16
Family Selenoprotein W-related 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4506887|ref|NP_003000.1|
Sequence length 87
Comment selenoprotein W [Homo sapiens]
Sequence
MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSK
KKGDGYVDTESKFLKLVAAIKAALAQG
Download sequence
Identical sequences P63302 P63303 Q5NVB2
ENSP00000470941 ENSP00000471149 ENSP00000473185 gi|4506887|ref|NP_003000.1| ENSP00000470941 ENSP00000471149 ENSP00000473185 NP_001036202.1.72884 NP_001127129.1.23681 NP_001148049.1.37143 NP_003000.1.87134 NP_003000.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]