SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4506925|ref|NP_003013.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506925|ref|NP_003013.1|
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.48e-18
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4506925|ref|NP_003013.1|
Sequence length 114
Comment SH3 domain-binding glutamic acid-rich-like protein [Homo sapiens]
Sequence
MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMRENVPENSRPA
TGYPLPPQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
Download sequence
Identical sequences A0A096MME1 A0A0D9RDZ9 A0A2J8USW6 A0A2K5EHB1 A0A2K5HB88 A0A2K5LRM7 A0A2K5QWI3 A0A2K5Z8U3 A0A2K6C1L4 F7GVV1 G1QQ20 G2HEW4 G3SIZ4 G7NS79 G7Q351 O75368 Q4R7R5 Q5RFN7 V9HW48
ENSP00000362308 NP_001124600.1.23681 NP_001233334.1.37143 NP_001253279.1.72884 NP_001270646.1.63531 NP_003013.1.87134 NP_003013.1.92137 XP_003269058.1.23891 XP_003824475.1.60992 XP_004064500.1.27298 XP_007990354.1.81039 XP_011710768.1.29376 XP_011799514.1.43180 XP_011826177.1.47321 XP_011826178.1.47321 XP_011932674.1.92194 XP_012311158.1.9421 XP_015299211.1.63531 XP_017364719.1.71028 ENSNLEP00000003038 ENSGGOP00000028084 ENSP00000362308 ENSPPYP00000022956 ENSCJAP00000006462 9600.ENSPPYP00000022956 9606.ENSP00000362308 ENSNLEP00000003038 ENSPTRP00000056448 ENSCJAP00000006465 ENSPPYP00000022956 ENSPTRP00000056448 gi|4506925|ref|NP_003013.1| ENSP00000362308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]