SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4507207|ref|NP_003121.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4507207|ref|NP_003121.1|
Domain Number 1 Region: 33-197
Classification Level Classification E-value
Superfamily EF-hand 7.57e-47
Family Penta-EF-hand proteins 0.000000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4507207|ref|NP_003121.1|
Sequence length 198
Comment sorcin isoform a [Homo sapiens]
Sequence
MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQ
SGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTV
DPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQ
QGVVNFPYDDFIQCVMSV
Download sequence
Identical sequences A0A2J8WK94 H2QUW0 P30626 Q5R4U9
ENSP00000265729 1juo_A 1juo_B 4u8d_A 4u8d_B 4usl_A 1juoA ENSPTRP00000033143 ENSP00000265729 NP_001127644.1.23681 NP_003121.1.87134 NP_003121.1.92137 XP_001164490.1.37143 XP_003822767.1.60992 ENSPTRP00000033143 gi|4507207|ref|NP_003121.1| ENSPPYP00000019992 ENSPPYP00000019992 9600.ENSPPYP00000019992 9606.ENSP00000265729 ENSP00000265729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]