SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4507241|ref|NP_003137.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4507241|ref|NP_003137.1|
Domain Number 1 Region: 194-427
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-86
Family SSRP1-like 0.00000495
Further Details:      
 
Domain Number 2 Region: 539-619
Classification Level Classification E-value
Superfamily HMG-box 1.83e-25
Family HMG-box 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4507241|ref|NP_003137.1|
Sequence length 709
Comment FACT complex subunit SSRP1 [Homo sapiens]
Sequence
MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGH
GLKLLTKNGHVYKYDGFRESEFEKLSDFFKTHYRLELMEKDLCVKGWNWGTVKFGGQLLS
FDIGDQPVFEIPLSNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEA
FAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVL
RLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVEKRFEG
RLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERGFI
YVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNA
KKLNIKNRGLKEGMNPSYDEYADSDEDQHDAYLERMKEEGKIREENANDSSDDSGEETDE
SFNPGEEEEDVAEEFDSNASASSSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKK
GKDPNAPKRPMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKA
EDARRDYEKAMKEYEGGRGESSKRDKSKKKKKVKVKMEKKSTPSRGSSSKSSSRQLSESF
KSKEFVSSDESSSGENKSKKKRRRSEDSEEEELASTPPSSEDSASGSDE
Download sequence
Identical sequences A0A024R4Z6 G3R9I5 K7CHU5 Q08945
ENSP00000278412 HR3575 ENSP00000278412 NP_003137.1.87134 NP_003137.1.92137 XP_003826485.1.60992 XP_003954279.2.37143 XP_004051198.1.27298 gi|4507241|ref|NP_003137.1| 9606.ENSP00000278412 ENSP00000278412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]