SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4507357|ref|NP_003555.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4507357|ref|NP_003555.1|
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.35e-47
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4507357|ref|NP_003555.1|
Sequence length 199
Comment transgelin-2 [Homo sapiens]
Sequence
MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGT
VLCELINALYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGK
NMACVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGT
NRGASQAGMTGYGMPRQIL
Download sequence
Identical sequences A0A0D9S3W2 A0A1D5RJC9 A0A250YBS4 A0A2K5MUF2 A0A2K5WZ75 A0A2K5ZKL3 A0A2K6EA24 A0A2K6QZE6 H2N562 H2Q0D6 P37802
ENSPPYP00000000757 ENSPTRP00000002581 ENSMMUP00000006251 ENSPPYP00000000757 ENSP00000357075 ENSP00000357077 ENSPTRP00000002581 ENSPANP00000004172 gi|4507357|ref|NP_003555.1| ENSMMUP00000006251 9544.ENSMMUP00000006251 9600.ENSPPYP00000000757 9606.ENSP00000357075 ENSP00000357075 ENSP00000357077 NP_001252829.1.72884 NP_001264152.1.87134 NP_001264152.1.92137 NP_003555.1.87134 NP_003555.1.92137 XP_002809978.1.23681 XP_003308584.1.37143 XP_003775568.1.23681 XP_003811949.1.60992 XP_005541350.1.63531 XP_005541351.1.63531 XP_005541352.1.63531 XP_007974741.1.81039 XP_007974742.1.81039 XP_009240431.1.23681 XP_009433699.1.37143 XP_010359081.1.97406 XP_010359082.1.97406 XP_011768346.1.29376 XP_011768347.1.29376 XP_011768348.1.29376 XP_011768349.1.29376 XP_011768350.1.29376 XP_011812588.1.43180 XP_011812589.1.43180 XP_011812590.1.43180 XP_011812591.1.43180 XP_011812592.1.43180 XP_011812593.1.43180 XP_011825799.1.47321 XP_011825800.1.47321 XP_011825801.1.47321 XP_011825802.1.47321 XP_011825803.1.47321 XP_011923070.1.92194 XP_011923071.1.92194 XP_011923072.1.92194 XP_011923073.1.92194 XP_011923074.1.92194 XP_011923075.1.92194 XP_014965737.1.72884 XP_014965743.1.72884 XP_015310517.1.63531 XP_015310520.1.63531 XP_017720327.1.44346 XP_017720328.1.44346 XP_020041099.1.5219 XP_020041100.1.5219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]