SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4507553|ref|NP_003266.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4507553|ref|NP_003266.1|
Domain Number 1 Region: 179-344
Classification Level Classification E-value
Superfamily RNI-like 3.4e-44
Family 28-residue LRR 0.00000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4507553|ref|NP_003266.1|
Sequence length 359
Comment tropomodulin-1 [Homo sapiens]
Sequence
MSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTG
PFKREELLDHLEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEAL
ANASDAELCDIAAILGMHTLMSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNS
TDVEETLERIKNNDPKLEEVNLNNIRNIPIPTLKAYAEALKENSYVKKFSIVGTRSNDPV
AYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNTSLVEMKIDNQSQPLGNKVEM
EIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGPIIPKCRSGV
Download sequence
Identical sequences P28289
ENSP00000259365 ENSP00000378637 ENSP00000259365 ENSP00000378637 ENSP00000259365 gi|260763922|ref|NP_001159588.1| gi|4507553|ref|NP_003266.1| NP_001159588.1.87134 NP_001159588.1.92137 NP_003266.1.87134 NP_003266.1.92137 9606.ENSP00000259365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]