SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4507705|ref|NP_003302.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4507705|ref|NP_003302.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000661
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4507705|ref|NP_003302.1|
Sequence length 152
Comment pleckstrin homology-like domain family A member 2 [Homo sapiens]
Sequence
MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDC
VERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPA
APAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
Download sequence
Identical sequences Q53GA4
9606.ENSP00000319231 ENSP00000319231 gi|4507705|ref|NP_003302.1| ENSP00000319231 ENSP00000483602 ENSP00000319231 NP_003302.1.87134 NP_003302.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]