SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4507869|ref|NP_003361.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4507869|ref|NP_003361.1|
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily PH domain-like 5.7e-47
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000918
Further Details:      
 
Domain Number 2 Region: 340-378
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.000000000000863
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4507869|ref|NP_003361.1|
Sequence length 380
Comment vasodilator-stimulated phosphoprotein [Homo sapiens]
Sequence
MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQV
VINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPP
PPALPTWSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPP
GPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGPGGGGAGAPGLAAAIAGAKLRKVSK
QEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVP
AQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQ
KVKEEIIEAFVQELRKRGSP
Download sequence
Identical sequences A0A024R0V4 P50552
ENSP00000245932 ENSP00000245932 gi|4507869|ref|NP_003361.1| 9606.ENSP00000245932 NP_003361.1.87134 NP_003361.1.92137 ENSP00000245932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]