SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|45243561|ref|NP_982353.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45243561|ref|NP_982353.1|
Domain Number 1 Region: 354-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000209
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 430-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000232
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 315-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000554
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 4 Region: 277-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000161
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 5 Region: 388-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000395
Family EGF-type module 0.0077
Further Details:      
 
Weak hits

Sequence:  gi|45243561|ref|NP_982353.1|
Domain Number - Region: 227-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0294
Family EGF-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|45243561|ref|NP_982353.1|
Sequence length 587
Comment delta-like protein 3 isoform 2 precursor [Homo sapiens]
Sequence
MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFF
RVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTF
SFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEP
PAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCL
EGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTC
PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ
PCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALG
FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAP
PGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHAL
PDALNNLRTQEGSGDGPSSSVDWNRPEDVDPQGIYVISAPSIYAREA
Download sequence
Identical sequences NP_982353.1.87134 NP_982353.1.92137 ENSP00000348810 gi|45243561|ref|NP_982353.1| ENSP00000348810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]