SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|45439342|ref|NP_689542.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45439342|ref|NP_689542.2|
Domain Number 1 Region: 109-325
Classification Level Classification E-value
Superfamily L domain-like 2.96e-30
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|45439342|ref|NP_689542.2|
Sequence length 414
Comment leucine-rich repeat protein 1 isoform 1 [Homo sapiens]
Sequence
MKLHCEVEVISRHLPALGLRNRGKGVRAVLSLCQQTSRSQPPVRAFLLISTLKDKRGTRY
ELRENIEQFFTKFVDEGKATVRLKEPPVDICLSKAISSSLKGFLSAMRLAHRGCNVDTPV
STLTPVKTSEFENFKTKMVITSKKDYPLSKNFPYSLEHLQTSYCGLVRVDMRMLCLKSLR
KLDLSHNHIKKLPATIGDLIHLQELNLNDNHLESFSVALCHSTLQKSLRSLDLSKNKIKA
LPVQFCQLQELKNLKLDDNELIQFPCKIGQLINLRFLSAARNKLPFLPSEFRNLSLEYLD
LFGNTFEQPKVLPVIKLQAPLTLLESSARTILHNRIPYGSHIIPFHLCQDLDTAKICVCG
RFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDMLK
Download sequence
Identical sequences Q96L50
9606.ENSP00000298288 ENSP00000315628 NP_689542.2.87134 NP_689542.2.92137 NYSGRC-45439342 ENSP00000298288 gi|45439342|ref|NP_689542.2| ENSP00000298288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]