SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|45505137|ref|NP_714914.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45505137|ref|NP_714914.2|
Domain Number 1 Region: 113-495
Classification Level Classification E-value
Superfamily L domain-like 1.7e-53
Family Ngr ectodomain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 399-638
Classification Level Classification E-value
Superfamily L domain-like 1.62e-47
Family Ngr ectodomain-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|45505137|ref|NP_714914.2|
Sequence length 661
Comment podocan isoform 1 [Homo sapiens]
Sequence
MEGARARGAQLRLGERVRPVGRRSAPGRSRFRQPWRPGASDSAPPAGTMAQSRVLLLLLL
LPPQLHLGPVLAVRAPGFGRSGGHSLSPEENEFAEEEPVLVLSPEEPGPGPAAVSCPRDC
ACSQEGVVDCGGIDLREFPGDLPEHTNHLSLQNNQLEKIYPEELSRLHRLETLNLQNNRL
TSRGLPEKAFEHLTNLNYLYLANNKLTLAPRFLPNALISVDFAANYLTKIYGLTFGQKPN
LRSVYLHNNKLADAGLPDNMFNGSSNVEVLILSSNFLRHVPKHLPPALYKLHLKNNKLEK
IPPGAFSELSSLRELYLQNNYLTDEGLDNETFWKLSSLEYLDLSSNNLSRVPAGLPRSLV
LLHLEKNAIRSVDANVLTPIRSLEYLLLHSNQLREQGIHPLAFQGLKRLHTVHLYNNALE
RVPSGLPRRVRTLMILHNQITGIGREDFATTYFLEELNLSYNRITSPQVHRDAFRKLRLL
RSLDLSGNRLHTLPPGLPRNVHVLKVKRNELAALARGALVGMAQLRELYLTSNRLRSRAL
GPRAWVDLAHLQLLDIAGNQLTEIPEGLPESLEYLYLQNNKISAVPANAFDSTPNLKGIF
LRFNKLAVGSVVDSAFRRLKHLQVLDIEGNLEFGDISKDRGRLGKEKEEEEEEEEEEEET
R
Download sequence
Identical sequences ENSP00000308315 gi|45505137|ref|NP_714914.2| ENSP00000360555 NP_714914.2.87134 NP_714914.2.92137 9606.ENSP00000308315 ENSP00000308315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]