SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4557377|ref|NP_000052.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4557377|ref|NP_000052.1|
Domain Number 1 Region: 382-648
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.58e-77
Family Protein kinases, catalytic subunit 0.000000000265
Further Details:      
 
Domain Number 2 Region: 4-168
Classification Level Classification E-value
Superfamily PH domain-like 4.48e-53
Family Pleckstrin-homology domain (PH domain) 0.0000000302
Further Details:      
 
Domain Number 3 Region: 251-378
Classification Level Classification E-value
Superfamily SH2 domain 3.42e-33
Family SH2 domain 0.000041
Further Details:      
 
Domain Number 4 Region: 206-274
Classification Level Classification E-value
Superfamily SH3-domain 1.02e-19
Family SH3-domain 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4557377|ref|NP_000052.1|
Sequence length 659
Comment tyrosine-protein kinase BTK [Homo sapiens]
Sequence
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDE
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES
Download sequence
Identical sequences A0A2I3NCH0 A0A2I3RVY9 A0A2K6A443 A0A2K6CUV5 A0A2K6PTH4 F6V0I6 G1R7I9 G3SKC9 G7Q392 Q06187
HR4731 ENSNLEP00000009167 ENSP00000308176 ENSP00000469726 9606.ENSP00000308176 ENSP00000361971 gi|4557377|ref|NP_000052.1| ENSP00000308176 ENSNLEP00000009167 NP_000052.1.87134 NP_000052.1.92137 XP_003276503.1.23891 XP_003810458.1.60992 XP_005594200.1.63531 XP_007990483.1.81039 XP_010357947.1.97406 XP_011770147.1.29376 XP_011820174.1.47321 XP_014983301.1.72884 XP_016798493.1.37143 XP_016802911.1.37143 XP_018874756.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]