SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4557522|ref|NP_000783.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4557522|ref|NP_000783.2|
Domain Number 1 Region: 88-246
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000844
Family Glutathione peroxidase-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4557522|ref|NP_000783.2|
Sequence length 249
Comment type I iodothyronine deiodinase isoform a [Homo sapiens]
Sequence
MGLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDN
WIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLN
FGSCTUPSFMFKFDQFKRLIEDFSSIADFLVIYIEEAHASDGWAFKNNMDIRNHQNLQDR
LQAAHLLLARSPQCPVVVDTMQNQSSQLYAALPERLYIIQEGRILYKGKSGPWNYNPEEV
RAVLEKLHS
Download sequence
Identical sequences P49895
ENSP00000354643 gi|4557522|ref|NP_000783.2| NP_000783.2.87134 NP_000783.2.92137 NYSGRC-4557522 ENSP00000354643 ENSP00000354643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]