SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4557617|ref|NP_000811.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4557617|ref|NP_000811.1|
Domain Number 1 Region: 261-450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.93e-41
Family Laminin G-like module 0.00000000497
Further Details:      
 
Domain Number 2 Region: 464-673
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-35
Family Laminin G-like module 0.00000000271
Further Details:      
 
Domain Number 3 Region: 49-106
Classification Level Classification E-value
Superfamily GLA-domain 4.04e-20
Family GLA-domain 0.00065
Further Details:      
 
Domain Number 4 Region: 152-283
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000141
Family Growth factor receptor domain 0.025
Further Details:      
 
Domain Number 5 Region: 118-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family EGF-type module 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4557617|ref|NP_000811.1|
Sequence length 678
Comment growth arrest-specific protein 6 isoform 1 precursor [Homo sapiens]
Sequence
MAPSLSPGPAALRRAPQLLLLLLAAECALAALLPAREATQFLRPRQRRAFQVFEEAKQGH
LERECVEELCSREEAREVFENDPETDYFYPRYLDCINKYGSPYTKNSGFATCVQNLPDQC
TPNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHC
SCHSGFELSSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKACRDVD
ECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCEDILPCVPFSVAKSVKSLYLGRM
FSGTPVIRLRFKRLQPTRLVAEFDFRTFDPEGILLFAGGHQDSTWIVLALRAGRLELQLR
YNGVGRVTSSGPVINHGMWQTISVEELARNLVIKVNRDAVMKIAVAGDLFQPERGLYHLN
LTVGGIPFHEKDLVQPINPRLDGCMRSWNWLNGEDTTIQETVKVNTRMQCFSVTERGSFY
PGSGFAFYSLDYMRTPLDVGTESTWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALV
DYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVS
AAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDEAAY
KHSDITAHSCPPVEPAAA
Download sequence
Identical sequences ENSP00000331831 NP_000811.1.87134 NP_000811.1.92137 gi|4557617|ref|NP_000811.1| ENSP00000331831 9606.ENSP00000331831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]