SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4557733|ref|NP_000419.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4557733|ref|NP_000419.1|
Domain Number 1 Region: 667-735
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.1e-20
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 1579-1638
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.7e-16
Family TB module/8-cys domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1413-1469,1497-1505
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000157
Family TB module/8-cys domain 0.00034
Further Details:      
 
Domain Number 4 Region: 853-970
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000753
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 5 Region: 928-1052
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000178
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 551-616
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000785
Family TB module/8-cys domain 0.0027
Further Details:      
 
Domain Number 7 Region: 1225-1345
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000157
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 1120-1220
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000722
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 9 Region: 616-662
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000315
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 10 Region: 1734-1818
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000116
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 11 Region: 1477-1528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family EGF-type module 0.011
Further Details:      
 
Domain Number 12 Region: 1044-1093
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 13 Region: 1339-1377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000041
Family EGF-type module 0.013
Further Details:      
 
Domain Number 14 Region: 1522-1567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000429
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 15 Region: 1091-1127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000252
Family EGF-type module 0.0089
Further Details:      
 
Weak hits

Sequence:  gi|4557733|ref|NP_000419.1|
Domain Number - Region: 190-223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000391
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 400-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000628
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4557733|ref|NP_000419.1|
Sequence length 1821
Comment latent-transforming growth factor beta-binding protein 2 precursor [Homo sapiens]
Sequence
MRPRTKARSPGRALRNPWRGFLPLTLALFVGAGHAQRDPVGRYEPAGGDANRLRRPGGSY
PAAAAAKVYSLFREQDAPVAGLQPVERAQPGWGSPRRPTEAEARRPSRAQQSRRVQPPAQ
TRRSTPLGQQQPAPRTRAAPALPRLGTPQRSGAAPPTPPRGRLTGRNVCGGQCCPGWTTA
NSTNHCIKPVCEPPCQNRGSCSRPQLCVCRSGFRGARCEEVIPDEEFDPQNSRLAPRRWA
ERSPNLRRSSAAGEGTLARAQPPAPQSPPAPQSPPAGTLSGLSQTHPSQQHVGLSRTVRL
HPTATASSQLSSNALPPGPGLEQRDGTQQAVPLEHPSSPWGLNLTEKIKKIKIVFTPTIC
KQTCARGHCANSCERGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPA
NSTGKFCHLPIPQPDREPPGRGSRPRALLEAPLKQSTFTLPLSNQLASVNPSLVKVHIHH
PPEASVQIHQVAQVRGGVEEALVENSVETRPPPWLPASPGHSLWDSNNIPARSGEPPRPL
PPAAPRPRGLLGRCYLNTVNGQCANPLLELTTQEDCCGSVGAFWGVTLCAPCPPRPASPV
IENGQLECPQGYKRLNLTHCQDINECLTLGLCKDAECVNTRGSYLCTCRPGLMLDPSRSR
CVSDKAISMLQGLCYRSLGPGTCTLPLAQRITKQICCCSRVGKAWGSECEKCPLPGTEAF
REICPAGHGYTYASSDIRLSMRKAEEEELARPPREQGQRSSGALPGPAERQPLRVVTDTW
LEAGTIPDKGDSQAGQVTTSVTHAPAWVTGNATTPPMPEQGIAEIQEEQVTPSTDVLVTL
STPGIDRCAAGATNVCGPGTCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLRDPCKGKG
RCINRVGSYSCFCYPGYTLATSGATQECQDINECEQPGVCSGGQCTNTEGSYHCECDQGY
IMVRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYRGQSGSCVDVNECLTPGVC
AHGKCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACEN
GYWVNEDGTACEDLDECAFPGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECE
DPQSSCLGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHGECLNSHGSFF
CLCAPGFVSAEGGTSCQDVDECATTDPCVGGHCVNTEGSFNCLCETGFQPSPESGECVDI
DECEDYGDPVCGTWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECANDTMCGSHGFCD
NTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYD
AQEGHCRPRGAGGQSMSEAPTGDHAPAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQ
GASWGDACDLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMYTDADECVIFGPGLCPNG
RCLNTVPGYVCLCNPGFHYDASHKKCEDHDECQDLACENGECVNTEGSFHCFCSPPLTLD
LSQQRCMNSTSSTEDLPDHDIHMDICWKKVTNDVCSEPLRGHRTTYTECCCQDGEAWSQQ
CALCPPRSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPDDLHYSIYGPDGAPFYNYL
GPEDTVPEPAFPNTAGHSADRTPILESPLQPSELQPHYVASHPEPPAGFEGLQAEECGIL
NGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSY
RCHCSPGYVAEAGPPHCTAKE
Download sequence
Identical sequences Q14767
NP_000419.1.87134 NP_000419.1.92137 9606.ENSP00000261978 ENSP00000261978 gi|4557733|ref|NP_000419.1| ENSP00000261978 ENSP00000261978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]