SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4557777|ref|NP_000249.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4557777|ref|NP_000249.1|
Domain Number 1 Region: 46-193
Classification Level Classification E-value
Superfamily EF-hand 1.51e-34
Family SCOPe 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4557777|ref|NP_000249.1|
Sequence length 195
Comment myosin light chain 3 [Homo sapiens]
Sequence
MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFML
FDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQH
ISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSN
GCINYEAFVKHIMSS
Download sequence
Identical sequences A0A024R2Q5 A0A2J8TFI4 G3QJD8 K7CZZ3 P08590 Q5R887
9600.ENSPPYP00000015580 9606.ENSP00000292327 ENSP00000292327 5tby_C 5tby_D ENSP00000292327 ENSP00000379210 gi|4557777|ref|NP_000249.1| ENSPPYP00000015580 ENSPPYP00000015580 NP_000249.1.87134 NP_000249.1.92137 NP_001127497.1.23681 XP_003818495.1.60992 XP_004034086.1.27298 XP_009237357.1.23681 XP_016796403.1.37143 ENSP00000292327 ENSP00000379210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]