SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4557795|ref|NP_000259.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4557795|ref|NP_000259.1|
Domain Number 1 Region: 215-356
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-42
Family Third domain of FERM 0.000000431
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 1.07e-37
Family Second domain of FERM 0.000000679
Further Details:      
 
Domain Number 3 Region: 503-595
Classification Level Classification E-value
Superfamily Moesin tail domain 7.06e-26
Family Moesin tail domain 0.0017
Further Details:      
 
Domain Number 4 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-25
Family First domain of FERM 0.00000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4557795|ref|NP_000259.1|
Sequence length 595
Comment merlin isoform 1 [Homo sapiens]
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPT
YPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN
ELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL
Download sequence
Identical sequences A0A024R1J8 A0A2I2YM46 A0A2K5P518 A0A2K5XBK8 A0A2K6NI47 P35240
NP_000259.1.87134 NP_000259.1.92137 XP_007973534.1.81039 XP_010357711.1.97406 XP_011851092.1.47321 XP_011893158.1.92194 XP_018874185.1.27298 ENSP00000344666 9606.ENSP00000344666 gi|4557795|ref|NP_000259.1| ENSP00000335160 ENSP00000344666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]