SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|45593138|ref|NP_660299.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45593138|ref|NP_660299.2|
Domain Number 1 Region: 42-110
Classification Level Classification E-value
Superfamily L domain-like 0.00000015
Family Ngr ectodomain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|45593138|ref|NP_660299.2|
Sequence length 305
Comment leucine-rich repeat-containing protein 25 precursor [Homo sapiens]
Sequence
MGGTLAWTLLLPLLLRESDSLEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRA
SNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCAL
ESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASATIGAVVVSGCLLLGLA
IAGPVLAWRLWRCRVARSRELNKPWAAQDGPKPGLGLQPRYGSRSAPKPQVAVPSCPSTP
DYENMFVGQPAAEHQWDEQGAHPSEDNDFYINYKDIDLASQPVYCNLQSLGQAPMDEEEY
VIPGH
Download sequence
Identical sequences Q8N386
NP_660299.2.87134 NP_660299.2.92137 XP_005259796.1.92137 gi|45593138|ref|NP_660299.2| ENSP00000340983 ENSP00000340983 ENSP00000472290 ENSP00000340983 ENSP00000472290 9606.ENSP00000340983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]