SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4585712|ref|NP_002520.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4585712|ref|NP_002520.2|
Domain Number 1 Region: 494-779
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.96e-81
Family Protein kinases, catalytic subunit 0.000000156
Further Details:      
 
Domain Number 2 Region: 62-183
Classification Level Classification E-value
Superfamily L domain-like 5.1e-23
Family Ngr ectodomain-like 0.000000556
Further Details:      
 
Domain Number 3 Region: 289-380
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000127
Family I set domains 0.00000372
Further Details:      
 
Domain Number 4 Region: 194-289
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000014
Family I set domains 0.00000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4585712|ref|NP_002520.2|
Sequence length 796
Comment high affinity nerve growth factor receptor isoform 2 [Homo sapiens]
Sequence
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG
Download sequence
Identical sequences P04629
NP_002520.2.87134 NP_002520.2.92137 NYSGRC-IgSF-NTRK1_HUMAN gi|4585712|ref|NP_002520.2| ENSP00000431418 ENSP00000431418 9606.ENSP00000351486 ENSP00000376120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]