SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46094068|ref|NP_689818.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46094068|ref|NP_689818.2|
Domain Number 1 Region: 69-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 17-70
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.98e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Weak hits

Sequence:  gi|46094068|ref|NP_689818.2|
Domain Number - Region: 146-289
Classification Level Classification E-value
Superfamily RNI-like 0.00785
Family 28-residue LRR 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46094068|ref|NP_689818.2|
Sequence length 327
Comment zinc finger protein 781 [Homo sapiens]
Sequence
MQRNAMYLKNVAETACNFQLTQYQISHANQKPYECQICGKPFRKRAHLTQHNRIHTGGKP
YECKECGKVFICCSTLIQHKRTHTSEKPYECLECRKTFRRSAHLIRHQRIHTGEKPYKCK
QCWKAFASVSDLIDIGKFTLMRDFTNVQNVGRHLTIAQLLFSIREFTLVRSPLNVRNVAK
HSIIAQHLLNTRELILMRNLMNVRNVKRLLGKVHILLNIKEFILVRNHMSVSNVGRLSLV
FLILIDIREFTLVKNPMNVKNVVELLTIVQLLFNTREFTLVRRLMNISSVGRFLSPVQHL
FNIREHILMKNLMNVSNARRPSSIMHI
Download sequence
Identical sequences A0A024R0G3
NP_689818.2.87134 NP_689818.2.92137 ENSP00000351391 ENSP00000466370 ENSP00000351391 9606.ENSP00000351391 ENSP00000351391 ENSP00000466370 gi|46094068|ref|NP_689818.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]