SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46094076|ref|NP_056331.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46094076|ref|NP_056331.2|
Domain Number 1 Region: 33-311
Classification Level Classification E-value
Superfamily L domain-like 2.95e-46
Family Ngr ectodomain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46094076|ref|NP_056331.2|
Sequence length 353
Comment tsukushin precursor [Homo sapiens]
Sequence
MPWPLLLLLAVSGAQTTRPCFPGCQCEVETFGLFDSFSLTRVDCSGLGPHIMPVPIPLDT
AHLDLSSNRLEMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGL
TALPAESFTSSPLSDVNLSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHRLVPHPTRAG
LPAPTIQSLNLAWNRLHAVPNLRDLPLRYLSLDGNPLAVIGPGAFAGLGGLTHLSLASLQ
RLPELAPSGFRELPGLQVLDLSGNPKLNWAGAEVFSGLSSLQELDLSGTNLVPLPEALLL
HLPALQSVSVGQDVRCRRLVREGTYPRRPGSSPKVALHCVDTRDSAARGPTIL
Download sequence
Identical sequences A0A024R5J8 Q8WUA8
NP_001245139.1.87134 NP_001245139.1.92137 NP_001305407.1.87134 NP_001305407.1.92137 NP_001305408.1.87134 NP_001305408.1.92137 NP_056331.2.87134 NP_056331.2.92137 gi|46094076|ref|NP_056331.2| ENSP00000332668 ENSP00000434847 ENSP00000332668 ENSP00000332668 ENSP00000434847 ENSP00000482145 9606.ENSP00000332668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]