SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46094081|ref|NP_060952.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46094081|ref|NP_060952.2|
Domain Number 1 Region: 560-709
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.16e-66
Family Ankyrin repeat 0.00000175
Further Details:      
 
Domain Number 2 Region: 53-290,322-347
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.29e-65
Family BAR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 438-555
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.59e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.0000053
Further Details:      
 
Domain Number 4 Region: 313-431
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-20
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 5 Region: 1053-1127
Classification Level Classification E-value
Superfamily SH3-domain 9.06e-16
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46094081|ref|NP_060952.2|
Sequence length 1129
Comment arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 [Homo sapiens]
Sequence
MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
QKEDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHAT
SNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALT
MAFRGEQSAGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGI
HREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRK
EYITAKYVDHRFSRKTCSTSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQEL
GETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTVLHYCSMYSKPECLKLLLRSK
PTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEIDESDDD
LDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFVSTST
DSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSD
PPSPLPHGPPNKGAVPWGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQK
VALRKTDHLSLDKATIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPKPQIGDLPPKPG
ELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLK
SHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQA
DNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Download sequence
Identical sequences Q9ULH1
9606.ENSP00000350297 gi|46094081|ref|NP_060952.2| ENSP00000429900 NP_060952.2.87134 NP_060952.2.92137 ENSP00000350297 ENSP00000429900 ENSP00000350297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]