SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46249349|ref|NP_004830.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46249349|ref|NP_004830.2|
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily PH domain-like 5.03e-49
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000198
Further Details:      
 
Weak hits

Sequence:  gi|46249349|ref|NP_004830.2|
Domain Number - Region: 104-331
Classification Level Classification E-value
Superfamily Tropomyosin 0.00124
Family Tropomyosin 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46249349|ref|NP_004830.2|
Sequence length 343
Comment homer protein homolog 2 isoform 1 [Homo sapiens]
Sequence
MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINST
ITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEK
IETSSNHSQASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANVKKWEIELQTLR
ESNARLTTALQESAASVEQWKRQFSICRDENDRLRNKIDELEEQCSEINREKEKNTQLKR
RIEELEAELREKETELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTD
IEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
Download sequence
Identical sequences K7C4B9
NP_004830.2.87134 NP_004830.2.92137 XP_016782796.1.37143 gi|46249349|ref|NP_004830.2| ENSP00000407634 ENSP00000407634 HOMER2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]