SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46249369|ref|NP_996837.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46249369|ref|NP_996837.1|
Domain Number 1 Region: 118-133,210-439
Classification Level Classification E-value
Superfamily RNI-like 3.34e-22
Family 28-residue LRR 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46249369|ref|NP_996837.1|
Sequence length 509
Comment melanoma antigen preferentially expressed in tumors [Homo sapiens]
Sequence
MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAA
FDGRHSQTLKAMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ
VLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVD
LFLKEGACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEV
TCTWKLPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQA
LYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVM
LTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI
SALQSLLQHLIGLSNLTHVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMV
WLSANPCPHCGDRTFYDPEPILCPCFMPN
Download sequence
Identical sequences A0A024R1E6 P78395
ENSP00000381726 ENSP00000381728 ENSP00000384343 ENSP00000385198 ENSP00000445097 ENSP00000445675 ENSP00000484066 ENSP00000381726 ENSP00000381728 ENSP00000384343 ENSP00000385198 ENSP00000445675 ENSP00000381726 HR6130 gi|46249367|ref|NP_996836.1| gi|46249369|ref|NP_996837.1| gi|46249371|ref|NP_996838.1| gi|46249373|ref|NP_996839.1| gi|5174641|ref|NP_006106.1| NP_001278644.1.87134 NP_001278644.1.92137 NP_001278645.1.87134 NP_001278645.1.92137 NP_006106.1.87134 NP_006106.1.92137 NP_996836.1.87134 NP_996836.1.92137 NP_996837.1.87134 NP_996837.1.92137 NP_996838.1.87134 NP_996838.1.92137 NP_996839.1.87134 NP_996839.1.92137 9606.ENSP00000351432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]