SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46409260|ref|NP_997190.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46409260|ref|NP_997190.1|
Domain Number 1 Region: 194-265
Classification Level Classification E-value
Superfamily EF-hand 0.0000238
Family Calmodulin-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|46409260|ref|NP_997190.1|
Sequence length 572
Comment EF-hand domain-containing protein C3orf25 [Homo sapiens]
Sequence
MDDDYEAYHSLFLSLLGLCPSKTPINENAPVFDPEPVIAHCFKQFQQKDFRLPQTRRRII
MVPRKEDQTPLNPASQPQAPPKPIPSFKVLEARDIQEQPEDRKTWLSQRSKLRQELESFG
DVKRWLENKPSITPSEAKVLHMIHEEQSAQPNASQATTRTTRKKAPRLSRLSRQMVPQLQ
LPEPPALSVMYSYLHSRKIKILEIFHKVGQGENQRITREEFIAAVKAVGVPLKNQEVEDI
VIYLSSLGKHNTITMDILANTYKQWSMAQQRSSLATAREHYILAKHRDSLKGPLKKQEVD
SAPQLPKVDLLTVPAVDTQMETRPMTLEEMEEVGKRYRERQRQHKLTIPSIQYTEQCHLV
RCGNRHFDEHCLPSTIHGDMRELIDSARRHNFLVYLQCWKLCKSYGLPLTEDILMKALLY
PGDKIIFQMDKVCPIRQPGGYYSDWKVFSPNLALLRSQGPGKSKRTDKKTPKKSKKMRFK
EFEEFTRKLKVKRSSGLQQTHPNSFWPGHLLDKLQLYLPTVATDRSLALFSCVQHQPHVY
PATYHPDHWWPLRNKNYMTHAHYDAAKVYYIN
Download sequence
Identical sequences Q6NXP0
gi|46409260|ref|NP_997190.1| NP_997190.1.87134 NP_997190.1.92137 ENSP00000324241 ENSP00000420854 ENSP00000324241 ENSP00000324241 ENSP00000420854 9606.ENSP00000324241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]