SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|47086907|ref|NP_060309.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|47086907|ref|NP_060309.2|
Domain Number 1 Region: 345-508
Classification Level Classification E-value
Superfamily EF-hand 5.16e-31
Family Calmodulin-like 0.0033
Further Details:      
 
Domain Number 2 Region: 73-317
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.00000000000000353
Family Glycerol-3-phosphate (1)-acyltransferase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|47086907|ref|NP_060309.2|
Sequence length 544
Comment lysophosphatidylcholine acyltransferase 2 [Homo sapiens]
Sequence
MSRCAQAAEVAATVPGAGVGNVGLRPPMVPRQASFFPPPVPNPFVQQTQIGSARRVQIVL
LGIILLPIRVLLVALILLLAWPFAAISTVCCPEKLTHPITGWRRKITQTALKFLGRAMFF
SMGFIVAVKGKIASPLEAPVFVAAPHSTFFDGIACVVAGLPSMVSRNENAQVPLIGRLLR
AVQPVLVSRVDPDSRKNTINEIIKRTTSGGEWPQILVFPEGTCTNRSCLITFKPGAFIPG
VPVQPVLLRYPNKLDTVTWTWQGYTFIQLCMLTFCQLFTKVEVEFMPVQVPNDEEKNDPV
LFANKVRNLMAEALGIPVTDHTYEDCRLMISAGQLTLPMEAGLVEFTKISRKLKLDWDGV
RKHLDEYASIASSSKGGRIGIEEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGL
AVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDS
ISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPEKHEESTSD
KKDD
Download sequence
Identical sequences Q7L5N7
ENSP00000262134 NYSGRC-47086907 9606.ENSP00000262134 NP_060309.2.87134 NP_060309.2.92137 gi|47086907|ref|NP_060309.2| ENSP00000262134 ENSP00000262134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]