SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|47132603|ref|NP_998758.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|47132603|ref|NP_998758.1|
Domain Number - Region: 47-184
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00207
Family Thioltransferase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|47132603|ref|NP_998758.1|
Sequence length 185
Comment type I iodothyronine deiodinase isoform b [Homo sapiens]
Sequence
MGLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGNRPLVLNFGSC
TUPSFMFKFDQFKRLIEDFSSIADFLVIYIEEAHASDGWAFKNNMDIRNHQNLQDRLQAA
HLLLARSPQCPVVVDTMQNQSSQLYAALPERLYIIQEGRILYKGKSGPWNYNPEEVRAVL
EKLHS
Download sequence
Identical sequences ENSP00000435725 NP_998758.1.87134 NP_998758.1.92137 ENSP00000435725 gi|47132603|ref|NP_998758.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]